PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_0501BC320.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 316aa    MW: 34967.7 Da    PI: 7.5793
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_0501BC320.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd++lv  ++ +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_2BL_0501BC320.2 14 RGPWTPEEDKILVAHIHSHGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                           89******************************99************97 PP

2Myb_DNA-binding44.92.7e-1467150148
                            TSSS-HHHHHHHHHHHHHTTTT.....................................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.....................................tWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE++ +++++++lG++                                     +W++Ia++++ gRt++++k+ w+++l
  Traes_2BL_0501BC320.2  67 RGNFTDEEEQSIIQLHQLLGNRcllllvaffllllnhiltvplllkrgqslplasiakqRWSAIAARLP-GRTDNEIKNVWHTHL 150
                            89*******************************************************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129423.283965IPR017930Myb domain
SMARTSM007174.0E-141363IPR001005SANT/Myb domain
PfamPF002494.9E-161461IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-231589IPR009057Homeodomain-like
CDDcd001677.97E-111661No hitNo description
PROSITE profilePS500909.38462150IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.1E-236585IPR009057Homeodomain-like
SMARTSM007176.4E-966152IPR001005SANT/Myb domain
PfamPF002491.1E-1167150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-23124154IPR009057Homeodomain-like
SuperFamilySSF466892.11E-7125155IPR009057Homeodomain-like
CDDcd001672.05E-4126150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDKILVAHIH SHGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TDEEEQSIIQ LHQLLGNRCL LLLVAFFLLL LNHILTVPLL LKRGQSLPLA  120
SIAKQRWSAI AARLPGRTDN EIKNVWHTHL KKRLDPSAQE QHEEAKKRKK PAAAARKRDG  180
KVKMRKLDAL TAKAAPVLSS PERSVSSTVT ESTSTASAAA EQHGNSGSSA SASASVKEEC  240
FTSSEESEEF QIDESFWSET LSMPLDDIND VCMEPHDAFG KPTGAADGDM DYWLKVFMEG  300
GGDDDNNNGA LDLPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-19121555109B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150169KKRLDPSAQEQHEEAKKRKK
2165169KKRKK
3168185KKPAAAARKRDGKVKMRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2521470.0AB252147.1 Triticum aestivum Tamyb7 mRNA for myb-related protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580139.11e-132PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-105MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW5B6C50.0W5B6C5_WHEAT; Uncharacterized protein
STRINGBRADI5G15760.11e-132(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-68myb domain protein 15
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]